Pay in 4 interest-free payments of $32.53 Learn more
Ships within 48 hours · Estimated delivery Jul 28 - Aug 2
RRID: AB_2840307
RRID: AB_2847280
RRID: AB_2845501
AA Sequence: MQGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
GeneID: 7263
OBCAM (E201) Polyclonal Antibody-BS2841 Insectogene RRID: AB_2840307OBCAM (E201) Polyclonal Antibody Catalogue Numbers: BS2841 50, BS2841 100 Product: Rabbit IgG, 1mg ml in PBS with 0. 02% sodium azide, 50% glycerol, pH7. 2 Swiss Prot: Q14982 Host: Rabbit Reactivity: Human, Mouse, Rat Applications: IHC All Applications: IHC: 1: 50~1: 200 Background: This gene encodes a member of the IgLON subfamily in the immunoglobulin protein superfamily. The encoded protein is localized in the plasma membrane and may have an